PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000433.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 191aa    MW: 20259.3 Da    PI: 6.1225
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000433.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1855.8e-5820115297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfedyveplkvyl
  Itr_sc000433.1_g00013.1  20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFEDYVEPLKVYL 105
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +++r++ege+
  Itr_sc000433.1_g00013.1 106 QRFRDMEGER 115
                              ********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5414127IPR009072Histone-fold
SuperFamilySSF471133.57E-4022126IPR009072Histone-fold
PfamPF008087.1E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-205371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-207290No hitNo description
PRINTSPR006151.4E-2091109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MADSDNESGG QRGNSESSPR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTV NGDDLLWAMT TLGFEDYVEP LKVYLQRFRD MEGERTAMAG  120
RQESGGGGNG GYAGESGVYH GMMMGQGQHH GHIYGSGAYN PMGGGGSGNP GSGYIGSGGP  180
PAADRPSRLG S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-4820110292Transcription factor HapC (Eurofung)
4g92_B6e-4820110292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876631e-75KC787663.1 Brassica napus transcription factor subunit NF-YB3B (NF-YB3B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634760.11e-89PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010644567.11e-89PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233103e-76NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG51e-89D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t013e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-74nuclear factor Y, subunit B3